PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00007977001
Common NameGSBRNA2T00007977001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 223aa    MW: 23905.5 Da    PI: 8.594
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00007977001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.43.1e-383090262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         ++++l+cprC+stntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rk+ k+s
  GSBRNA2T00007977001 30 QQEQLPCPRCNSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGTRKSAKRS 90
                         68999***************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-27481IPR003851Zinc finger, Dof-type
PfamPF027014.8E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1433488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MMMSDSGEPR QTAMRPHGVI TGLPPTANEQ QEQLPCPRCN STNTKFCYYN NYNFSQPRHF  60
CKSCRRYWTH GGTLRDIPVG GGTRKSAKRS RTCSSSSSGT RTTSVPLPAT PVLFPHSSTS  120
NGVSHTVTAP LENDGKGNAL SLSGNFTSLL NQNNAGSSFD DVSFALGRAV WPFPTVGDSA  180
TTNVPGVAVP YTWQFEGLES SNAGEYFAWP DLSITTPGNS LK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.85521e-142seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893790.0AC189379.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB049N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115716.11e-164PREDICTED: dof zinc finger protein DOF3.4-like
SwissprotQ390884e-99DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLA0A078IS761e-165A0A078IS76_BRANA; BnaAnng11790D protein
STRINGBra036082.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.11e-89OBF binding protein 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]